PDB entry 1niy

View 1niy on RCSB PDB site
Description: three dimensional solution structure of hainantoxin-IV by 2d 1h-nmr
Class: toxin
Keywords: neurotoxin, inhibitor cystine knot motif
Deposited on 2002-12-30, released 2003-01-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hainantoxin-IV
  Species: Ornithoctonus hainana [TaxId:209901]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P83471 (0-34)
  Domains in SCOPe 2.01: d1niya_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1niyA (A:)
  eclgfgkgcnpsndqcckssnlvcsrkhrwckyei