PDB entry 1nit

View 1nit on RCSB PDB site
Description: crystal structure of aconitase with trans-aconitate and nitrocitrate bound
Class: lyase(carbon-oxygen)
Keywords: lyase(carbon-oxygen)
Deposited on 1993-01-17, released 1993-10-31
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aconitase
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nita1, d1nita2
  • Heterogens: SO4, SF4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nitA (A:)
    erakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkt
    ylrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdin
    qevynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicig
    vggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaivey
    hgpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlv
    pdsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctn
    ssyedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlana
    cgpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkf
    npetdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlql
    lepfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainsenr
    kansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehraleprflggraii
    tksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkpltciikhpng
    tqetillnhtfnetqiewfragsalnrmkelqqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nitA (A:)
    rakvamshfepheyirydlleknidivrkrlnrpltlsekivyghlddpanqeiergkty
    lrlrpdrvamqdataqmamlqfissglpkvavpstihcdhlieaqlggekdlrrakdinq
    evynflatagakygvgfwrpgsgiihqiilenyaypgvlligtdshtpnggglggicigv
    ggadavdvmagipwelkcpkvigvkltgslsgwtspkdvilkvagiltvkggtgaiveyh
    gpgvdsisctgmaticnmgaeigattsvfpynhrmkkylsktgradianladefkdhlvp
    dsgchydqlieinlselkphingpftpdlahpvaevgsvaekegwpldirvgligsctns
    syedmgrsaavakqalahglkcksqftitpgseqiratierdgyaqvlrdvggivlanac
    gpcigqwdrkdikkgekntivtsynrnftgrndanpethafvtspeivtalaiagtlkfn
    petdfltgkdgkkfkleapdadelpraefdpgqdtyqhppkdssgqrvdvsptsqrlqll
    epfdkwdgkdledlqilikvkgkcttdhisaagpwlkfrghldnisnnlligainsenrk
    ansvrnavtqefgpvpdtaryykqhgirwvvigdenygegssrehraleprflggraiit
    ksfarihetnlkkqgllpltfadpadynkihpvdkltiqglkdfapgkpltciikhpngt
    qetillnhtfnetqiewfragsalnrmkelqqk