PDB entry 1nir

View 1nir on RCSB PDB site
Description: oxydized nitrite reductase from pseudomonas aeruginosa
Deposited on 1997-06-17, released 1997-12-03
The last revision prior to the SCOP 1.69 freeze date was dated 1997-12-03, with a file datestamp of 1997-12-03.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.209
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nirA (A:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nirA (A:)
    aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
    ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpemr
    eswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhisr
    msasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiagay
    wppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkvl
    lvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdvg
    ktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggslf
    ikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqpe
    ynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nirB (B:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nirB (B:)
    kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
    pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpem
    reswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhis
    rmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiaga
    ywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkv
    llvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdv
    gktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggsl
    fikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqp
    eynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy