PDB entry 1nir

View 1nir on RCSB PDB site
Description: oxydized nitrite reductase from pseudomonas aeruginosa
Class: nitrite reductase
Keywords: nitrite reductase, pseudomonas aeruginosa, hemoprotein, denitrification, domain swapping
Deposited on 1997-06-17, released 1997-12-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.15 Å
R-factor: 0.209
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nira1, d1nira2
  • Chain 'B':
    Compound: nitrite reductase
    Species: Pseudomonas aeruginosa [TaxId:287]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nirb1, d1nirb2
  • Heterogens: PO4, CL, OH, HEC, DHE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nirA (A:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nirA (A:)
    aaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkpltp
    ditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpemr
    eswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhisr
    msasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiagay
    wppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkvl
    lvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdvg
    ktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggslf
    ikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqpe
    ynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nirB (B:)
    kddmkaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatg
    kpltpditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewg
    mpemreswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgya
    vhisrmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedryt
    iagaywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvke
    tgkvllvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsa
    lvdvgktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqg
    ggslfikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakr
    vvqpeynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqh
    dvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nirB (B:)
    kaaeqyqgaasavdpahvvrtngapdmsesefneakqiyfqrcagchgvlrkgatgkplt
    pditqqrgqqylealitygtplgmpnwgssgelskeqitlmakyiqhtppqppewgmpem
    reswkvlvkpedrpkkqlndldlpnlfsvtlrdagqialvdgdskkivkvidtgyavhis
    rmsasgryllvigrdaridmidlwakeptkvaeikigiearsvesskfkgyedrytiaga
    ywppqfaimdgetlepkqivstrgmtvdtqtyhpeprvaaiiashehpefivnvketgkv
    llvnykdidnltvtsigaapflhdggwdsshryfmtaannsnkvavidskdrrlsalvdv
    gktphpgrganfvhpkygpvwstshlgdgsisligtdpknhpqyawkkvaelqgqgggsl
    fikthpksshlyvdttfnpdarisqsvavfdlknldakyqvlpiaewadlgegakrvvqp
    eynkrgdevwfsvwngkndssalvvvddktlklkavvkdprlitptgkfnvyntqhdvy