PDB entry 1nip

View 1nip on RCSB PDB site
Description: crystallographic structure of the nitrogenase iron protein from azotobacter vinelandii
Class: iron protein
Keywords: iron protein
Deposited on 1992-09-29, released 1993-10-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.183
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nipa_
  • Chain 'B':
    Compound: nitrogenase iron protein
    Species: Azotobacter vinelandii [TaxId:354]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nipb_
  • Heterogens: MG, SF4, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nipA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nipA (A:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nipB (B:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktaeev
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nipB (B:)
    amrqcaiygkggigkstttqnlvaalaemgkkvmivgcdpkadstrlilhskaqntimem
    aaeagtvedleledvlkagyggvkcvesggpepgvgcagrgvitainfleeegayeddld
    fvfydvlgdvvcggfampirenkaqeiyivcsgemmamyaanniskgivkyansgsvrlg
    glicnsrntdredeliialanklgtqmihfvprdnvvqraeirrmtvieydpkakqadey
    ralarkvvdnkllvipnpitmdeleellmefgimevedesivgktae