PDB entry 1nio

View 1nio on RCSB PDB site
Description: crystal structure of beta-luffin, a ribosome inactivating protein at 2.0a resolution
Deposited on 2002-12-24, released 2003-08-05
The last revision prior to the SCOP 1.67 freeze date was dated 2003-08-05, with a file datestamp of 2003-08-05.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.162
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.67: d1nioa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nioA (A:)
    anvsfslsgadsksyskfitalrkalpskekvsniplllpsasgasryilmqlsnydaka
    itmaidvtnvyimgylvnstsyffnesdaklasqyvfkgstivtlpysgnyerlqnaagk
    vrekiplgfrafdsaitslfhydstaaagaflviiqttaeasrfkyiegqiikripknev
    pspaalslenewsalskqiqlaqtnngafrtpvviidnkgqrveikdvnskvvtnnikll
    lnkqnia