PDB entry 1nic

View 1nic on RCSB PDB site
Description: the structure of cu-nitrite reductase from achromobacter cycloclastes at five ph values, with nitrite bound and with type II cu depleted
Class: oxidoreductase (nitric oxide(a))
Keywords: oxidoreductase (nitric oxide(a))
Deposited on 1995-07-03, released 1995-12-07
The last revision prior to the SCOP 1.75 freeze date was dated 1995-12-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.168
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nitrite reductase
    Species: Achromobacter cycloclastes
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1nica1, d1nica2
  • Heterogens: CU, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nicA (A:)
    aagaapvdistlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteih
    amtfngsvpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeet
    tlrfkatkpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvge
    qdfyvpkdeagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavger
    vlvvhsqanrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgv
    yayvnhnlieafelgaaghfkvtgewnddlmtsvvkpasm
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nicA (A:)
    distlprvkvdlvkppfvhahdqvaktgprvveftmtieekklvidregteihamtfngs
    vpgplmvvhendyvelrlinpdtntllhnidfhaatgalgggaltqvnpgeettlrfkat
    kpgvfvyhcapegmvpwhvtsgmngaimvlprdglkdekgqpltydkiyyvgeqdfyvpk
    deagnykkyetpgeayedavkamrtltpthivfngavgaltgdhaltaavgervlvvhsq
    anrdtrphligghgdyvwatgkfrnppdldqetwlipggtagaafytfrqpgvyayvnhn
    lieafelgaaghfkvtgewnddlmtsvvkpasm