PDB entry 1ni7

View 1ni7 on RCSB PDB site
Description: northeast structural genomic consortium target er75
Class: STRUCTURAL GENOMICS, Unknown function
Keywords: ER75, RD-NMR, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, Unknown function
Deposited on 2002-12-21, released 2003-06-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein ygdK
    Species: Escherichia coli [TaxId:562]
    Gene: YGDK
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q46926 (0-146)
      • expression tag (147-148)
    Domains in SCOPe 2.07: d1ni7a1, d1ni7a2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ni7A (A:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni7A (A:)
    mtnpqfaghpfgttvtaetlrntfapltqwedkyrqlimlgkqlpalpdelkaqakeiag
    cenrvwlgytvaengkmhffgdsegrivrgllavlltavegktaaelqaqsplalfdelg
    lraqlsasrsqglnalseaiiaatkqvle