PDB entry 1ni6

View 1ni6 on RCSB PDB site
Description: Comparisions of the Heme-Free and-Bound Crystal Structures of Human Heme Oxygenase-1
Class: oxygen storage/transport
Keywords: heme oxygenase-1, heme degradation, OXYGEN STORAGE/TRANSPORT COMPLEX
Deposited on 2002-12-21, released 2003-04-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ni6a_
  • Chain 'B':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ni6b_
  • Chain 'C':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ni6c_
  • Chain 'D':
    Compound: Heme oxygenase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: HMOX1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ni6d_
  • Heterogens: CL, TRE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ni6A (A:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni6A (A:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellthd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ni6B (B:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni6B (B:)
    pqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernk
    espvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepell
    vahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsl
    emtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ni6C (C:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni6C (C:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellth
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ni6D (D:)
    merpqpdsmpqdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyva
    leeeiernkespvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhe
    vgrtepellvahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkq
    lyrsrmnslemtpavrqrvieeaktafllniqlfeelqellthd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni6D (D:)
    qdlsealkeatkevhtqaenaefmrnfqkgqvtrdgfklvmaslyhiyvaleeeiernke
    spvfapvyfpeelhrkaaleqdlafwygprwqevipytpamqryvkrlhevgrtepellv
    ahaytrylgdlsggqvlkkiaqkaldlpssgeglafftfpniasatkfkqlyrsrmnsle
    mtpavrqrvieeaktafllniqlfeelqellth