PDB entry 1ni5

View 1ni5 on RCSB PDB site
Description: Structure of the MesJ PP-ATPase from Escherichia Coli
Class: cell cycle
Keywords: STRUCTURAL GENOMICS, ATPase, PP-type, putative cell cycle protein, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, CELL CYCLE
Deposited on 2002-12-21, released 2003-01-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.223
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative cell cycle protein mesJ
    Species: Escherichia coli [TaxId:562]
    Gene: MESJ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52097 (1-432)
      • cloning artifact (0)
      • modified residue (1)
      • modified residue (140)
      • modified residue (246)
      • modified residue (249)
      • modified residue (269)
    Domains in SCOPe 2.06: d1ni5a1, d1ni5a3, d1ni5a4, d1ni5a5
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ni5A (A:)
    smtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanada
    wvthcenvcqqwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhldd
    qcetfllalkrgsgpaglsamaevsefagtrlirpllartrgelvqwarqydlrwiedes
    nqddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldelladdlahcqspqg
    tlqivpmlamsdarraaiirrwlagqnapmpsrdalvriwqevalaredaspclrlgafe
    irryqsqlwwiksvtgqsenivpwqtwlqplelpaglgsvqlnaggdirppradeavsvr
    fkapgllhivgrnggrklkkiwqelgvppwlrdttpllfygetliaaagvfvtqegvaeg
    engvsfvwqktls