PDB entry 1ni5

View 1ni5 on RCSB PDB site
Description: structure of the mesj pp-atpase from escherichia coli
Deposited on 2002-12-21, released 2003-01-07
The last revision prior to the SCOP 1.71 freeze date was dated 2003-01-07, with a file datestamp of 2003-01-07.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ni5A (A:)
    smtltlnrqlltsrqilvafsggldstvllhqlvqwrtenpgvalraihvhhglsanada
    wvthcenvcqqwqvplvvervqlaqeglgieaqarqaryqafartllpgevlvtaqhldd
    qcetfllalkrgsgpaglsamaevsefagtrlirpllartrgelvqwarqydlrwiedes
    nqddsydrnflrlrvvpllqqrwphfaeatarsaalcaeqeslldelladdlahcqspqg
    tlqivpmlamsdarraaiirrwlagqnapmpsrdalvriwqevalaredaspclrlgafe
    irryqsqlwwiksvtgqsenivpwqtwlqplelpaglgsvqlnaggdirppradeavsvr
    fkapgllhivgrnggrklkkiwqelgvppwlrdttpllfygetliaaagvfvtqegvaeg
    engvsfvwqktls