PDB entry 1ni3

View 1ni3 on RCSB PDB site
Description: Structure of the Schizosaccharomyces pombe YchF GTPase
Class: hydrolase
Keywords: STRUCTURAL GENOMICS, G-protein, GTPase, YCHF, GTP1OBG, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, HYDROLASE
Deposited on 2002-12-20, released 2003-01-07
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.213
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: YchF GTP-binding protein
    Species: Schizosaccharomyces pombe [TaxId:4896]
    Gene: SPAC27E2.03C
    Database cross-references and differences (RAF-indexed):
    • Uniprot O13998
      • modified residue (27)
      • modified residue (178)
      • modified residue (232)
      • modified residue (264)
      • modified residue (292)
      • modified residue (349)
      • modified residue (378)
    Domains in SCOPe 2.05: d1ni3a1, d1ni3a2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ni3A (A:)
    mppkkqqevvkvqwgrpgnnlktgivgmpnvgkstffraitksvlgnpanypyatidpee
    akvavpderfdwlceaykpksrvpafltvfdiagltkgastgvglgnaflshvravdaiy
    qvvrafddaeiihvegdvdpirdlsiivdellikdaefvekhleglrkitsrgantlemk
    akkeeqaiiekvyqyltetkqpirkgdwsnreveiinslylltakpviylvnmserdflr
    qknkylpkikkwidenspgdtlipmsvafeerltnfteeeaieeckklntksmlpkiivt
    gynalnlinyftcgedevrswtirkgtkapqaagvihtdfekafvvgeimhyqdlfdykt
    enacraagkyltkgkeyvmesgdiahwkagkr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ni3A (A:)
    kvqwgrpgnnlktgivgmpnvgkstffraitksvlgnpanypyatidpeeakvavpderf
    dwlceaykpksrvpafltvfdiagltkgastgvglgnaflshvravdaiyqvvrafddae
    iihvegdvdpirdlsiivdellikdaefvekhleglrkitsrgantlemkakkeeqaiie
    kvyqyltetkqpirkgdwsnreveiinslylltakpviylvnmserdflrqknkylpkik
    kwidenspgdtlipmsvafeerltnfteeeaieeckklntksmlpkiivtgynalnliny
    ftcgedevrswtirkgtkapqaagvihtdfekafvvgeimhyqdlfdyktenacraagky
    ltkgkeyvmesgdiahwk