PDB entry 1ni2

View 1ni2 on RCSB PDB site
Description: structure of the active ferm domain of ezrin
Deposited on 2002-12-20, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ni2A (A:)
    pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
    dkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppet
    avllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehrg
    mlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfp
    wseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ni2B (B:)
    pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
    dkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppet
    avllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehrg
    mlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfp
    wseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp