PDB entry 1ni2

View 1ni2 on RCSB PDB site
Description: Structure of the active FERM domain of Ezrin
Class: Structural protein
Keywords: FERM, KEYSTONE, UBIQUITIN-LIKE DOMAIN, ACYL-COA-LIKE DOMAIN, PH/PTB-LIKE DOMAIN, Structural protein
Deposited on 2002-12-20, released 2003-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ezrin
    Species: Homo sapiens [TaxId:9606]
    Gene: VIL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ni2a1, d1ni2a2, d1ni2a3
  • Chain 'B':
    Compound: Ezrin
    Species: Homo sapiens [TaxId:9606]
    Gene: VIL2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1ni2b1, d1ni2b2, d1ni2b3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ni2A (A:)
    pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
    dkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppet
    avllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehrg
    mlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfp
    wseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ni2B (B:)
    pkpinvrvttmdaelefaiqpnttgkqlfdqvvktiglrevwyfglhyvdnkgfptwlkl
    dkkvsaqevrkenplqfkfrakfypedvaeeliqditqklfflqvkegilsdeiycppet
    avllgsyavqakfgdynkevhksgylsserlipqrvmdqhkltrdqwedriqvwhaehrg
    mlkdnamleylkiaqdlemyginyfeiknkkgtdlwlgvdalglniyekddkltpkigfp
    wseirnisfndkkfvikpidkkapdfvfyaprlrinkrilqlcmgnhelymrrrkp