PDB entry 1nhy

View 1nhy on RCSB PDB site
Description: Crystal Structure of the GST-like Domain of Elongation Factor 1-gamma from Saccharomyces cerevisiae.
Class: translation
Keywords: Protein synthesis, GST-like, TRANSLATION
Deposited on 2002-12-20, released 2003-01-14
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.235
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-gamma 1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TEF3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29547 (0-218)
      • engineered (0)
      • engineered (63)
      • engineered (78)
      • engineered (132)
    Domains in SCOPe 2.01: d1nhya1, d1nhya2
  • Heterogens: SO4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nhyA (A:)
msqgtlyanfrirtwvprglvkalkldvkvvtpdaaaeqfardfplkkvpafvgpkgykl
teamainyylvklsqddkmktqllgadddlnaqaqiirwqslansdlciqiantivplkg
gapynkksvdsamdavdkivdifenrlknytylatenisladlvaasiftryfeslfgte
wraqhpaivrwfntvraspflkdeykdfkfadkplsppq