PDB entry 1nhq

View 1nhq on RCSB PDB site
Description: crystallographic analyses of nadh peroxidase cys42ala and cys42ser mutants: active site structure, mechanistic implications, and an unusual environment of arg303
Deposited on 1994-12-09, released 1995-02-14
The last revision prior to the SCOP 1.59 freeze date was dated 1995-02-14, with a file datestamp of 1995-02-17.
Experiment type: -
Resolution: 2 Å
R-factor: 0.183
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhq_ (-)
    mkvivlgsshggyeaveellnlhpdaeiqwyekgdfisflssgmqlylegkvkdvnsvry
    mtgekmesrgvnvfsnteitaiqpkehqvtvkdlvsgeervenydkliispgavpfeldi
    pgkdldniylmrgrqwaiklkqktvdpevnnvvvigsgyigieaaeafakagkkvtvidi
    ldrplgvyldkeftdvlteemeannitiatgetveryegdgrvqkvvtdknaydadlvvv
    avgvrpntawlkgtlelhpngliktdeymrtsepdvfavgdatlikynpadtevnialat
    narkqgrfavknleepvkpfpgvqgssglavfdykfastginevmaqklgketkavtvve
    dylmdfnpdkqkawfklvydpettqilgaqlmskadltaninaislaiqakmtiedlaya
    dfffqpafdkpwniintaaleavkqer