PDB entry 1nho

View 1nho on RCSB PDB site
Description: Structural and Functional characterization of a Thioredoxin-like Protein from Methanobacterium thermoautotrophicum
Class: oxidoreductase
Keywords: beta sheet, alpha helix
Deposited on 2002-12-19, released 2003-08-26
The last revision prior to the SCOP 1.73 freeze date was dated 2003-08-26, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable Thioredoxin
    Species: Methanobacterium thermoautotrophicum
    Gene: MTH807
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1nhoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhoA (A:)
    mvvnievftsptcpycpmaievvdeakkefgdkidvekidimvdrekaieyglmavpaia
    ingvvrfvgapsreelfeaindeme