PDB entry 1nho

View 1nho on RCSB PDB site
Description: Structural and Functional characterization of a Thioredoxin-like Protein from Methanobacterium thermoautotrophicum
Deposited on 2002-12-19, released 2003-08-26
The last revision prior to the SCOP 1.69 freeze date was dated 2003-08-26, with a file datestamp of 2003-08-26.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Domains in SCOP 1.69: d1nhoa_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nhoA (A:)
  mvvnievftsptcpycpmaievvdeakkefgdkidvekidimvdrekaieyglmavpaia
  ingvvrfvgapsreelfeaindeme