PDB entry 1nho

View 1nho on RCSB PDB site
Description: Structural and Functional characterization of a Thioredoxin-like Protein from Methanobacterium thermoautotrophicum
Class: oxidoreductase
Keywords: beta sheet, alpha helix, OXIDOREDUCTASE
Deposited on 2002-12-19, released 2003-08-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable Thioredoxin
    Species: METHANOTHERMOBACTER THERMAUTOTROPHICUS [TaxId:187420]
    Gene: MTH807
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nhoa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nhoA (A:)
mvvnievftsptcpycpmaievvdeakkefgdkidvekidimvdrekaieyglmavpaia
ingvvrfvgapsreelfeaindeme