PDB entry 1nhm

View 1nhm on RCSB PDB site
Description: the structure of the hmg box and its interaction with dna
Deposited on 1994-11-17, released 1995-02-07
The last revision prior to the SCOP 1.55 freeze date was dated 1995-02-07, with a file datestamp of 1995-02-14.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.11 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d1nhm__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1nhm_ (-)
  napkrppsafflfcseyrpkikgehpglsigdvakklgemwnntaaddkqpyekkaaklk
  ekyekdiaayrakgkpdaa