PDB entry 1nhk

View 1nhk on RCSB PDB site
Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution
Class: phosphotransferase
Keywords: phosphotransferase
Deposited on 1994-12-09, released 1995-03-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'L':
    Compound: Nucleoside diphosphate kinase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: CMP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nhkl_
  • Chain 'R':
    Compound: Nucleoside diphosphate kinase
    Species: MYXOCOCCUS XANTHUS [TaxId:34]
    Gene: CMP
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nhkr_
  • Heterogens: CMP, HOH

PDB Chain Sequences:

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1nhkL (L:)
    aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
    dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
    lenakieiayffreteihsypyqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nhkL (L:)
    aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
    dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
    lenakieiayffreteihsypyq
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhkR (R:)
    aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
    dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
    lenakieiayffreteihsypyqk