PDB entry 1nhj

View 1nhj on RCSB PDB site
Description: Crystal structure of N-terminal 40KD MutL/A100P mutant protein complex with ADPnP and one sodium
Class: replication, signaling protein
Keywords: DNA mismatch repair, MutL, ATPase, Rubidium, REPLICATION, SIGNALING PROTEIN
Deposited on 2002-12-19, released 2003-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.217
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein mutL
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: MUTL
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8XDN4 (2-332)
      • expression tag (0-1)
      • see remark 999 (101)
      • engineered (132)
    Domains in SCOPe 2.06: d1nhja1, d1nhja2, d1nhja3
  • Heterogens: NA, MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nhjA (A:)
shmpiqvlppqlanqiaagevverpasvvkelvensldagatrididierggaklirird
ngcgikkdelalalarhatskiaslddleaiislgfrgealpsissvsrltltsrtaeqq
eawqayaegrdmnvtvkpaahpvgttlevldlfyntparrkflrtektefnhideiirri
alarfdvtinlshngkivrqyravpeggqkerrlgaicgtafleqalaiewqhgdltlrg
wvadpnhttpalaeiqycyvngrmmrdrlinhairqacedklgadqqpafvlyleidphq
vdvnvhpakhevrfhqsrlvhdfiyqgvlsvlq