PDB entry 1nhg

View 1nhg on RCSB PDB site
Description: crystal structure analysis of plasmodium falciparum enoyl-acyl-carrier-protein reductase with triclosan
Deposited on 2002-12-19, released 2003-02-25
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-25, with a file datestamp of 2003-02-25.
Experiment type: XRAY
Resolution: 2.43 Å
R-factor: 0.171
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.63: d1nhg.1
  • Chain 'B':
    Domains in SCOP 1.63: d1nhg.2
  • Chain 'C':
    Domains in SCOP 1.63: d1nhg.1
  • Chain 'D':
    Domains in SCOP 1.63: d1nhg.2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhgA (A:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraataink
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhgB (B:)
    edicfiagigdtngygwgiakelskrnvkiifgiwppvynifmknykngkfdndmiidkd
    kkmnildmlpfdasfdtandideetknnkrynmlqnytiedvanlihqkygkinmlvhsl
    anakevqkdllntsrkgyldalskssyslislckyfvnimkpqssiisltyhasqkvvpg
    ygggmssakaalesdtrvlayhlgrnynirintisagplksraataink
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhgC (C:)
    ytfidyaieysekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhgD (D:)
    ytfidyaieysekyaplrqkllstdigsvasfllsresraitgqtiyvdnglnimflpdd