PDB entry 1nhc

View 1nhc on RCSB PDB site
Description: Structural insights into the processivity of endopolygalacturonase I from Aspergillus niger
Class: hydrolase
Keywords: beta-helix, HYDROLASE
Deposited on 2002-12-19, released 2003-11-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.176
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polygalacturonase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nhca_
  • Chain 'B':
    Compound: Polygalacturonase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nhcb_
  • Chain 'C':
    Compound: Polygalacturonase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nhcc_
  • Chain 'D':
    Compound: Polygalacturonase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nhcd_
  • Chain 'E':
    Compound: Polygalacturonase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nhce_
  • Chain 'F':
    Compound: Polygalacturonase I
    Species: Aspergillus niger [TaxId:5061]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1nhcf_
  • Heterogens: MAN, NAG, SO4, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhcA (A:)
    stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
    plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
    tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
    nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
    vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
    ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhcB (B:)
    stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
    plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
    tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
    nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
    vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
    ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhcC (C:)
    stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
    plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
    tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
    nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
    vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
    ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhcD (D:)
    stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
    plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
    tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
    nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
    vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
    ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhcE (E:)
    stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
    plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
    tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
    nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
    vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
    ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nhcF (F:)
    stctftsaseasesisscsdvvlssievpagetldlsdaadgstitfegttsfgykewkg
    plirfggkdltvtmadgavidgdgsrwwdskgtnggktkpkfmyihdvedstfkginikn
    tpvqaisvqatnvhlndftidnsdgddngghntdgfdisestgvyisgatvknqddciai
    nsgesisftggtcsgghglsigsvggrddntvknvtisdstvsnsangvriktiyketgd
    vseitysniqlsgitdygivieqdyengsptgtpstgipitdvtvdgvtgtleddatqvy
    ilcgdgscsdwtwsgvdlsggktsdkcenvpsgasc