PDB entry 1nh9

View 1nh9 on RCSB PDB site
Description: Crystal Structure of a DNA Binding Protein Mja10b from the hyperthermophile Methanococcus jannaschii
Class: DNA binding protein
Keywords: Mja10b, DNA Binding Protein
Deposited on 2002-12-19, released 2003-12-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding protein Alba
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1nh9a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1nh9A (A:)
mdnvvligkkpvmnyvvavltqltsndeviikargkainkavdvaemirnrfikdikikk
ieigtdkvknpdgrevnvstieivlak

    Sequence, based on observed residues (ATOM records): (download) 
    >1nh9A (A:)
mdnvvligkkpvmnyvvavltqltsndeviikargkainkavdvaemirnrfikdikikk
ieigtdkevnvstieivlak