PDB entry 1nh9

View 1nh9 on RCSB PDB site
Description: Crystal Structure of a DNA Binding Protein Mja10b from the hyperthermophile Methanococcus jannaschii
Deposited on 2002-12-19, released 2003-12-23
The last revision prior to the SCOP 1.69 freeze date was dated 2003-12-23, with a file datestamp of 2003-12-23.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1nh9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1nh9A (A:)
mdnvvligkkpvmnyvvavltqltsndeviikargkainkavdvaemirnrfikdikikk
ieigtdkvknpdgrevnvstieivlak

    Sequence, based on observed residues (ATOM records): (download) 
    >1nh9A (A:)
mdnvvligkkpvmnyvvavltqltsndeviikargkainkavdvaemirnrfikdikikk
ieigtdkevnvstieivlak