PDB entry 1nh8

View 1nh8 on RCSB PDB site
Description: ATP phosphoribosyltransferase (ATP-prtase) from mycobacterium tuberculosis in complex with amp and histidine
Class: transferase
Keywords: PRTASE, DE NOVO HIS BIOSYNTHESIS, PRPP, TRANSFERASE, PHOSPHORIBOSYLTRANSFERASE, Structural Genomics, PSI, Protein Structure Initiative, TB Structural Genomics Consortium, TBSGC
Deposited on 2002-12-18, released 2003-02-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.199
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP phosphoribosyltransferase
    Species: Mycobacterium tuberculosis H37Rv [TaxId:83332]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1nh8a1, d1nh8a2
  • Heterogens: SO4, AMP, HIS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nh8A (A:)
    hsgrpvlgsshhhhhhssgmmlrvavpnkgalsepateilaeagyrrrtdskdltvidpv
    nnveffflrpkdiaiyvgsgeldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagr
    nwttadlagmriataypnlvrkdlatkgieatvirldgaveisvqlgvadaiadvvgsgr
    tlsqhdlvafgeplcdseavlieragtdgqdqteardqlvarvqgvvfgqqylmldydcp
    rsalkkataitpglesptiapladpdwvairalvprrdvngimdelaaigakailasdir
    fcrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh8A (A:)
    mlrvavpnkgalsepateilaeagyrrrtdskdltvidpvnnveffflrpkdiaiyvgsg
    eldfgitgrdlvcdsgaqvrerlalgfgsssfryaapagrnwttadlagmriataypnlv
    rkdlatkgieatvirldgaveisvqlgvadaiadvvgsgrtlsqhdlvafgeplcdseav
    lieraeardqlvarvqgvvfgqqylmldydcprsalkkataitpglesptiapladpdwv
    airalvprrdvngimdelaaigakailasdirfcrf