PDB entry 1nh6

View 1nh6 on RCSB PDB site
Description: structure of s. marcescens chitinase a, e315l, complex with hexasaccharide
Deposited on 2002-12-18, released 2003-03-18
The last revision prior to the SCOP 1.69 freeze date was dated 2004-09-07, with a file datestamp of 2004-09-07.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nh6A (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwlfpggkgan
    pnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq