PDB entry 1nh6

View 1nh6 on RCSB PDB site
Description: Structure of S. marcescens chitinase A, E315L, complex with hexasaccharide
Class: hydrolase
Keywords: (beta/alpha)8-barrel, oligosaccharide complex, hydrolase
Deposited on 2002-12-18, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.197
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase a
    Species: Serratia marcescens [TaxId:615]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB BAA31567 (0-539)
      • engineered (291)
      • see remark 999 (451)
      • see remark 999 (460)
    Domains in SCOPe 2.07: d1nh6a1, d1nh6a2, d1nh6a3
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nh6A (A:)
    aapgkptiawgntkfaivevdqaataynnlvkvknaadvsvswnlwngdtgttakvllng
    keawsgpstgssgtanfkvnkggryqmqvalcnadgctasdateivvadtdgshlaplke
    plleknkpykqnsgkvvgsyfvewgvygrnftvdkipaqnlthllygfipicggnginds
    lkeiegsfqalqrscqgredfkvsihdpfaalqkaqkgvtawddpykgnfgqlmalkqah
    pdlkilpsiggwtlsdpfffmgdkvkrdrfvgsvkeflqtwkffdgvdidwlfpggkgan
    pnlgspqdgetyvllmkelramldqlsvetgrkyeltsaisagkdkidkvaynvaqnsmd
    hiflmsydfygafdlknlghqtalnapawkpdtayttvngvnallaqgvkpgkivvgtam
    ygrgwtgvngyqnnipftgtatgpvkgtwengivdyrqiasqfmsgewqytydataeapy
    vfkpstgdlitfddarsvqakgkyvldkqlgglfsweidadngdilnsmnaslgnsagvq