PDB entry 1nh3

View 1nh3 on RCSB PDB site
Description: Human Topoisomerase I Ara-C Complex
Class: isomerase/DNA
Keywords: Ara-C, protein-DNA complex, DNA damage, isomerase, ISOMERASE/DNA COMPLEX
Deposited on 2002-12-18, released 2003-03-04
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.235
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA topoisomerase I
    Species: Homo sapiens [TaxId:9606]
    Gene: TOP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P11387 (0-562)
      • modified residue (520)
    Domains in SCOPe 2.02: d1nh3a1, d1nh3a2
  • Chain 'B':
    Compound: 5'-d(*ap*ap*ap*ap*ap*gp*ap*cp*up*(ubb))-3'
  • Chain 'C':
    Compound: 5'-d(*(gng)p*gp*ap*ap*ap*ap*ap*up*up*up*up*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*ap*ap*tp*up*up*up*up*cp*(car)p*ap*ap*gp*up*cp*up*up*up*up*t)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nh3A (A:)
    wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
    mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
    eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
    iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkk
    vveskkkavqrleeqlmklevqatdreenkqialgtsklnyldpritvawckkwgvpiek
    iynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh3A (A:)
    wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
    mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
    eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
    iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.