PDB entry 1nh3

View 1nh3 on RCSB PDB site
Description: Human Topoisomerase I Ara-C Complex
Deposited on 2002-12-18, released 2003-03-04
The last revision prior to the SCOP 1.67 freeze date was dated 2003-04-08, with a file datestamp of 2003-04-08.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.235
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1nh3A (A:)
    wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
    mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
    eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
    iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravailcnhqrappktfeksmmnlqtkidakkeqladarrdlksakadakvmkdaktkk
    vveskkkavqrleeqlmklevqatdreenkqialgtsklnyldpritvawckkwgvpiek
    iynktqrekfawaidmadedyef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh3A (A:)
    wkwweeerypegikwkflehkgpvfappyeplpenvkfyydgkvmklspkaeevatffak
    mldheyttkeifrknffkdwrkemtneekniitnlskcdftqmsqyfkaqtearkqmske
    eklkikeenekllkeygfcimdnhkerianfkieppglfrgrgnhpkmgmlkrrimpedi
    iincskdakvpspppghkwkevrhdnkvtwlvswteniqgsikyimlnpssrikgekdwq
    kyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalragnekeegetadtv
    gccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfknlqlfmenkqped
    dlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapdenipakilsynra
    nravsklnyldpritvawckkwgvpiekiynktqrekfawaidmadedyef