PDB entry 1nh2

View 1nh2 on RCSB PDB site
Description: Crystal structure of a yeast TFIIA/TBP/DNA complex
Class: transcription/DNA
Keywords: transcription/DNA
Deposited on 2002-12-18, released 2003-10-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.201
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: SPT15 OR BTF1 OR YER148W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nh2a1, d1nh2a2
  • Chain 'B':
    Compound: Transcription initiation factor IIA large chain
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOA1 OR YOR194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nh2b_
  • Chain 'C':
    Compound: Transcription initiation factor IIA large chain
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOA1 OR YOR194C
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nh2c_
  • Chain 'D':
    Compound: Transcription initiation factor IIA small chain
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TOA2 OR YKL058W
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1nh2d1, d1nh2d2
  • Chain 'E':
    Compound: 5'-d(*tp*gp*tp*ap*(5iu)p*gp*tp*ap*tp*ap*(5iu)p*ap*ap*ap*ap*c)-3'
  • Chain 'F':
    Compound: 5'-d(*gp*tp*tp*tp*tp*ap*tp*ap*tp*ap*cp*ap*tp*ap*cp*a)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nh2A (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1nh2B (B:)
    snaeasrvyeiivesvvnevredfenagideqtlqdlkniwqkkltetkvttf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh2B (B:)
    naeasrvyeiivesvvnevredfenagideqtlqdlkniwqkklte
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1nh2C (C:)
    gssalldtdevgselddsdddylisegeedgpdenlmlclydkvtrtkarwkcslkdgvv
    tinrndytfqkaqveaewv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh2C (C:)
    dylienlmlclydkvtrtkarwkcslkdgvvtinrndytfqkaqveaewv
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1nh2D (D:)
    avpgyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqsklt
    vkgnldtygfcddvwtfivkncqvtvedshrdasqngsgdsqsvisvdklrivacnskks
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >1nh2D (D:)
    gyyelyrrstignslvdaldtlisdgrieaslamrvletfdkvvaetlkdntqskltvkg
    nldtygfcddvwtfivkncqvtvedqsvisvdklrivacnskks
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.