PDB entry 1ngz

View 1ngz on RCSB PDB site
Description: Chimeric Germline Fab 7g12-apo
Class: immune system
Keywords: antibody, immunoglobulin, antigen binding fragment (Fab)
Deposited on 2002-12-18, released 2003-02-04
The last revision prior to the SCOP 1.73 freeze date was dated 2003-03-18, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.207
AEROSPACI score: -1.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germline Metal Chelatase Catalytic Antibody, Light chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.73: d1ngza1, d1ngza2
  • Chain 'B':
    Compound: Germline Metal Chelatase Catalytic Antibody, Heavy chain
    Species: Mus Musculus, Homo sapiens
    Domains in SCOP 1.73: d1ngzb1, d1ngzb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngzA (A:)
    elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngzB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepkscdkt