PDB entry 1ngy

View 1ngy on RCSB PDB site
Description: Chimeric Mature Fab 7g12-Apo
Deposited on 2002-12-18, released 2003-02-04
The last revision prior to the SCOP 1.71 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.235
AEROSPACI score: -1.66 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngyA (A:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrge
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngyB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkvepks