PDB entry 1ngx

View 1ngx on RCSB PDB site
Description: Chimeric Germline Fab 7g12 with jeffamine fragment bound
Class: immune system
Keywords: antibody, immunoglobulin, antigen binding fragment (Fab), IMMUNE SYSTEM
Deposited on 2002-12-18, released 2003-03-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.225
AEROSPACI score: -1.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Germline Metal Chelatase Catalytic Antibody, Light chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NGX (0-212)
    Domains in SCOPe 2.07: d1ngxa1, d1ngxa2
  • Chain 'B':
    Compound: Germline Metal Chelatase Catalytic Antibody, Heavy chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NGX (0-215)
    Domains in SCOPe 2.07: d1ngxb1, d1ngxb2
  • Chain 'H':
    Compound: Germline Metal Chelatase Catalytic Antibody, Heavy chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NGX (0-215)
    Domains in SCOPe 2.07: d1ngxh1, d1ngxh2
  • Chain 'L':
    Compound: Germline Metal Chelatase Catalytic Antibody, Light chain
    Species: , [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NGX (0-212)
    Domains in SCOPe 2.07: d1ngxl1, d1ngxl2
  • Heterogens: JEF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngxA (A:)
    elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngxB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngxH (H:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyyctrrdsdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngxL (L:)
    elvmtqtpkfmstsvgdrvsitckasqnvgtavawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne