PDB entry 1ngw

View 1ngw on RCSB PDB site
Description: chimeric affinity matured fab 7g12 complexed with mesoporphyrin
Deposited on 2002-12-18, released 2003-02-04
The last revision prior to the SCOP 1.69 freeze date was dated 2003-03-18, with a file datestamp of 2003-03-18.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.275
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwA (A:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwH (H:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwL (L:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne