PDB entry 1ngw

View 1ngw on RCSB PDB site
Description:
Deposited on 2002-12-18, released 2003-02-04
The last revision prior to the SCOP 1.63 freeze date was dated 2003-02-04, with a file datestamp of 2003-02-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.275
AEROSPACI score: -1.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ngwa1, d1ngwa2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ngwb1, d1ngwb2
  • Chain 'H':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ngwh1, d1ngwh2
  • Chain 'L':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1ngwl1, d1ngwl2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwA (A:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwH (H:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwL (L:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne