PDB entry 1ngw

View 1ngw on RCSB PDB site
Description: Chimeric Affinity Matured Fab 7g12 complexed with mesoporphyrin
Class: immune system
Keywords: antibody, immunoglobulin, antigen binding fragment, IMMUNE SYSTEM
Deposited on 2002-12-18, released 2003-02-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.275
AEROSPACI score: -1.8 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mature Metal Chelatase Catalytic Antibody, Light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NGW (0-212)
    Domains in SCOPe 2.07: d1ngwa1, d1ngwa2
  • Chain 'B':
    Compound: Mature Metal Chelatase Catalytic Antibody, Heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngwb1, d1ngwb2
  • Chain 'H':
    Compound: Mature Metal Chelatase Catalytic Antibody, Heavy chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngwh1, d1ngwh2
  • Chain 'L':
    Compound: Mature Metal Chelatase Catalytic Antibody, Light chain
    Species: Mus musculus, Homo sapiens [TaxId:10090,9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 1NGW (0-212)
    Domains in SCOPe 2.07: d1ngwl1, d1ngwl2
  • Heterogens: MMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwA (A:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwH (H:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngwL (L:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne