PDB entry 1ngs

View 1ngs on RCSB PDB site
Description: complex of transketolase with thiamin diphosphate, ca2+ and acceptor substrate erythrose-4-phosphate
Deposited on 1996-09-25, released 1997-02-12
The last revision prior to the SCOP 1.59 freeze date was dated 1997-02-12, with a file datestamp of 1997-02-13.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngsA (A:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngsB (B:)
    qftdidklavstirilavdtvskansghpgaplgmapaahvlwsqmrmnptnpdwinrdr
    fvlsnghavallysmlhltgydlsiedlkqfrqlgsrtpghpefelpgvevttgplgqgi
    snavgmamaqanlaatynkpgftlsdnytyvflgdgclqegisseasslaghlklgnlia
    iyddnkitidgatsisfdedvakryeaygwevlyvengnedlagiakaiaqaklskdkpt
    likmtttigygslhagshsvhgaplkaddvkqlkskfgfnpdksfvvpqevydhyqktil
    kpgveannkwnklfseyqkkfpelgaelarrlsgqlpanwesklptytakdsavatrkls
    etvledvynqlpeliggsadltpsnltrwkealdfqppssgsgnysgryirygirehamg
    aimngisafganykpyggtflnfvsyaagavrlsalsghpviwvathdsigvgedgpthq
    pietlahfrslpniqvwrpadgnevsaayknsleskhtpsiialsrqnlpqlegssiesa
    skggyvlqdvanpdiilvatgsevslsveaaktlaaknikarvvslpdfftfdkqpleyr
    lsvlpdnvpimsvevlattcwgkyahqsfgidrfgasgkapevfkffgftpegvaeraqk
    tiafykgdklisplkkaf