PDB entry 1ngq

View 1ngq on RCSB PDB site
Description: n1g9 (igg1-lambda) fab fragment
Class: immunoglobulin
Keywords: immunoglobulin,
Deposited on 1995-06-23, released 1996-07-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.194
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: n1g9 (igg1-lambda)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01751 (0-End)
      • conflict (0)
      • conflict (2)
      • conflict (4-6)
      • conflict (8-9)
      • conflict (12)
      • conflict (15)
      • conflict (19)
      • conflict (30)
      • conflict (33-34)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53-54)
      • conflict (56)
      • conflict (58)
      • conflict (65)
      • conflict (71)
      • conflict (73-74)
      • conflict (94)
      • insertion (98)
      • conflict (99)
      • conflict (108)
      • conflict (115)
      • conflict (193)
    Domains in SCOPe 2.07: d1ngqh1, d1ngqh2
  • Chain 'L':
    Compound: n1g9 (igg1-lambda)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-End)
    Domains in SCOPe 2.07: d1ngql1, d1ngql2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ngqH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngqH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss
    akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsspwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ngqL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngqL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsr