PDB entry 1ngp

View 1ngp on RCSB PDB site
Description: n1g9 (igg1-lambda) fab fragment complexed with (4-hydroxy-3-nitrophenyl) acetate
Class: immunoglobulin
Keywords: immunoglobulin,
Deposited on 1995-06-23, released 1996-07-11
The last revision prior to the SCOP 1.73 freeze date was dated 1996-07-11, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.196
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: n1g9 (igg1-lambda)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01751 (0-End)
      • conflict (0)
      • conflict (2)
      • conflict (4-6)
      • conflict (8-9)
      • conflict (12)
      • conflict (15)
      • conflict (19)
      • conflict (30)
      • conflict (33-34)
      • conflict (42)
      • conflict (49)
      • conflict (51)
      • conflict (53-54)
      • conflict (56)
      • conflict (58)
      • conflict (65)
      • conflict (71)
      • conflict (73-74)
      • conflict (94)
      • insertion (98)
      • conflict (99)
      • conflict (108)
      • conflict (115)
      • conflict (193)
    Domains in SCOP 1.73: d1ngph1, d1ngph2
  • Chain 'L':
    Compound: n1g9 (igg1-lambda)
    Species: Mus musculus
    Database cross-references and differences (RAF-indexed):
    • GB AAA39089 (0-End)
    Domains in SCOP 1.73: d1ngpl1, d1ngpl2
  • Heterogens: SO4, NPA, HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ngpH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss
    akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
    lytlsssvtvpsspwpsetvtcnvahpasstkvdkkivprdc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngpH (H:)
    qvqlqqpgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtky
    nekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttltvss
    akttppsvyplapgssmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdlytls
    ssvtvpsspwpsetvtcnvahpasstkvdkkivpr
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ngpL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsradcs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngpL (L:)
    qavvtqesalttspgetvtltcrsstgavttsnyanwvqekpdhlftgliggtnnrapgv
    parfsgsligdkaaltitgaqtedeaiyfcalwysnhwvfgggtkltvlgqpksspsvtl
    fppsseeletnkatlvctitdfypgvvtvdwkvdgtpvtqgmettqpskqsnnkymassy
    ltltarawerhssyscqvtheghtvekslsr