PDB entry 1ngm

View 1ngm on RCSB PDB site
Description: Crystal structure of a yeast Brf1-TBP-DNA ternary complex
Class: transcription/DNA
Keywords: transcription, tfiiib, tbp, brf, brf1, taf, protein-DNA complex, transcription/DNA complex
Deposited on 2002-12-17, released 2003-03-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.95 Å
R-factor: 0.278
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcription initiation factor TFIID
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngma1, d1ngma2
  • Chain 'B':
    Compound: Transcription factor IIIB BRF1 subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29056 (2-71)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1ngmb1, d1ngmb2
  • Chain 'C':
    Compound: 5'-d(*cp*tp*ap*tp*ap*ap*ap*ap*ap*ap*ap*tp*gp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'D':
    Compound: 5'-d(*ap*ap*ap*ap*ap*ap*cp*ap*tp*tp*tp*tp*tp*tp*tp*ap*tp*ap*g)-3'
  • Chain 'E':
    Compound: Transcription initiation factor TFIID
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngme1, d1ngme2
  • Chain 'F':
    Compound: Transcription factor IIIB BRF1 subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29056 (2-71)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1ngmf1, d1ngmf2
  • Chain 'G':
    Compound: 5'-d(*cp*tp*ap*tp*ap*ap*ap*ap*ap*ap*ap*tp*gp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'H':
    Compound: 5'-d(*ap*ap*ap*ap*ap*ap*cp*ap*tp*tp*tp*tp*tp*tp*tp*ap*tp*ap*g)-3'
  • Chain 'I':
    Compound: Transcription initiation factor TFIID
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngmi1, d1ngmi2
  • Chain 'J':
    Compound: Transcription factor IIIB BRF1 subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngmj_
  • Chain 'K':
    Compound: 5'-d(*cp*tp*ap*tp*ap*ap*ap*ap*ap*ap*ap*tp*gp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'L':
    Compound: 5'-d(*ap*ap*ap*ap*ap*ap*cp*ap*tp*tp*tp*tp*tp*tp*tp*ap*tp*ap*g)-3'
  • Chain 'M':
    Compound: Transcription initiation factor TFIID
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngmm1, d1ngmm2
  • Chain 'N':
    Compound: Transcription factor IIIB BRF1 subunit
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ngmn_
  • Chain 'O':
    Compound: 5'-d(*cp*tp*ap*tp*ap*ap*ap*ap*ap*ap*ap*tp*gp*tp*tp*tp*tp*tp*t)-3'
  • Chain 'P':
    Compound: 5'-d(*ap*ap*ap*ap*ap*ap*cp*ap*tp*tp*tp*tp*tp*tp*tp*ap*tp*ap*g)-3'

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngmA (A:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngmB (B:)
    gsycprnlhllpttdtylskvsddpdnledvddeelnahllneeasklkeriwiglnadf
    lleqeskrlkqe
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngmE (E:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngmF (F:)
    gsycprnlhllpttdtylskvsddpdnledvddeelnahllneeasklkeriwiglnadf
    lleqeskrlkqe
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    No sequence available.

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngmI (I:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ngmJ (J:)
    gsycprnlhllpttdtylskvsddpdnledvddeelnahllneeasklkeriwiglnadf
    lleqeskrlkqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngmJ (J:)
    kvsddpdnledvddeelnahllneeasklkeriwiglnadflleqeskrlkqe
    

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ngmM (M:)
    sgivptlqnivatvtlgcrldlktvalharnaeynpkrfaavimrirepkttalifasgk
    mvvtgakseddsklasrkyariiqkigfaakftdfkiqnivgscdvkfpirleglafshg
    tfssyepelfpgliyrmvkpkivllifvsgkivltgakqreeiyqafeaiypvlsefrkm
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ngmN (N:)
    gsycprnlhllpttdtylskvsddpdnledvddeelnahllneeasklkeriwiglnadf
    lleqeskrlkqe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngmN (N:)
    kvsddpdnledvddeelnahllneeasklkeriwiglnadflleqeskrlkqe
    

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.