PDB entry 1ngl

View 1ngl on RCSB PDB site
Description: human neutrophil gelatinase-associated lipocalin (hngal), regularised average nmr structure
Class: transport protein
Keywords: transport protein, mmp-9 component, lipocalin
Deposited on 1999-02-23, released 1999-05-26
The last revision prior to the SCOP 1.73 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ngal)
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80188 (1-178)
      • see remark 999 (0)
    Domains in SCOP 1.73: d1ngla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1nglA (A:)
    mqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelk
    edksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqha
    mvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg