PDB entry 1ngl

View 1ngl on RCSB PDB site
Description: human neutrophil gelatinase-associated lipocalin (hngal), regularised average nmr structure
Deposited on 1999-02-23, released 1999-05-26
The last revision prior to the SCOP 1.65 freeze date was dated 1999-06-07, with a file datestamp of 1999-06-06.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.08 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ngla_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1nglA (A:)
mqdstsdlipapplskvplqqnfqdnqfqgkwyvvglagnailredkdpqkmyatiyelk
edksynvtsvlfrkkkcdywirtfvpgcqpgeftlgniksypgltsylvrvvstnynqha
mvffkkvsqnreyfkitlygrtkeltselkenfirfskslglpenhivfpvpidqcidg