PDB entry 1ngk

View 1ngk on RCSB PDB site
Description: Crystallographic Structure of Mycobacterium tuberculosis Hemoglobin O
Deposited on 2002-12-17, released 2003-05-20
The last revision prior to the SCOP 1.65 freeze date was dated 2003-05-20, with a file datestamp of 2003-05-20.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.188
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1ngka_
  • Chain 'B':
    Domains in SCOP 1.65: d1ngkb_
  • Chain 'C':
    Domains in SCOP 1.65: d1ngkc_
  • Chain 'D':
    Domains in SCOP 1.65: d1ngkd_
  • Chain 'E':
    Domains in SCOP 1.65: d1ngke_
  • Chain 'F':
    Domains in SCOP 1.65: d1ngkf_
  • Chain 'G':
    Domains in SCOP 1.65: d1ngkg_
  • Chain 'H':
    Domains in SCOP 1.65: d1ngkh_
  • Chain 'I':
    Domains in SCOP 1.65: d1ngki_
  • Chain 'J':
    Domains in SCOP 1.65: d1ngkj_
  • Chain 'K':
    Domains in SCOP 1.65: d1ngkk_
  • Chain 'L':
    Domains in SCOP 1.65: d1ngkl_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ngkA (A:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkA (A:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ngkB (B:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkB (B:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ngkC (C:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkC (C:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1ngkD (D:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkD (D:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1ngkE (E:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkE (E:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ngkF (F:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkF (F:)
    ksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprty
    seqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaahs
    lvnspf
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ngkG (G:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkG (G:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ngkH (H:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkH (H:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ngkI (I:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkI (I:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ngkJ (J:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkJ (J:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1ngkK (K:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkK (K:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1ngkL (L:)
    mpksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggpr
    tyseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaa
    hslvnspf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ngkL (L:)
    pksfydavggaktfdaivsrfyaqvaedevlrrvypeddlagaeerlrmfleqywggprt
    yseqrghprlrmrhapfrislierdawlrcmhtavasidsetlddehrrelldylemaah
    slvnspf