PDB entry 1ng9

View 1ng9 on RCSB PDB site
Description: E.coli MutS R697A: an ATPase-asymmetry mutant
Deposited on 2002-12-17, released 2003-02-11
The last revision prior to the SCOP 1.67 freeze date was dated 2003-02-11, with a file datestamp of 2003-02-11.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ng9A (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigagtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng9A (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgag
    rstfmvemtetanilhnateyslvlmdeigagtstydglslawacaenlankikaltlfa
    thyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalagvpkevi
    krarqklrelesis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ng9B (B:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigagtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng9B (B:)
    ahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpipmagipyhav
    enylaklvnqgesvaiceqverkvvrivtpgtisdeallqerqdnllaaiwqdskgfgya
    tldissgrfrlsepadretmaaelqrtnpaellyaedfaemsliegrrglrrrplwefei
    dtarqqlnlqfgtrdlvgfgvenaprglcaagcllqyakdtqrttlphirsitmereqds
    iimdaatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqq
    tigalqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvd
    sapvqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdy
    lerlevrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipel
    keyedkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
    ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
    talialmayigsyvpaqkveigpidriftrvgastfmvemtetanilhnateyslvlmde
    igagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgd
    tiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis