PDB entry 1ng9

View 1ng9 on RCSB PDB site
Description: E.coli MutS R697A: an ATPase-asymmetry mutant
Class: DNA binding protein
Keywords: ABC ATPase, alternating ATPase, asymmetry, DNA repair, DNA binding, DNA BINDING PROTEIN
Deposited on 2002-12-17, released 2003-02-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA mismatch repair protein muts
    Species: Escherichia coli [TaxId:562]
    Gene: MUTS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23909 (0-799)
      • engineered (696)
    Domains in SCOPe 2.07: d1ng9a1, d1ng9a2, d1ng9a3, d1ng9a4
  • Chain 'B':
    Compound: DNA mismatch repair protein muts
    Species: Escherichia coli [TaxId:562]
    Gene: MUTS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P23909 (Start-799)
      • engineered (696)
    Domains in SCOPe 2.07: d1ng9b1, d1ng9b2, d1ng9b3, d1ng9b4
  • Chain 'E':
    Compound: 5'-d(*ap*gp*cp*tp*gp*cp*cp*ap*gp*gp*cp*ap*cp*cp*ap*gp*tp*gp*tp*cp*ap*gp*cp*gp*tp*cp*cp*tp*ap*t)-3'
  • Chain 'F':
    Compound: 5'-d(*ap*tp*ap*gp*gp*ap*cp*gp*cp*tp*gp*ap*cp*ap*cp*tp*gp*gp*tp*gp*cp*tp*tp*gp*gp*cp*ap*gp*cp*t)-3'
  • Heterogens: MG, ADP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ng9A (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigagtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng9A (A:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgag
    rstfmvemtetanilhnateyslvlmdeigagtstydglslawacaenlankikaltlfa
    thyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalagvpkevi
    krarqklrelesis
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ng9B (B:)
    msaienfdahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltkrga
    sagepipmagipyhavenylaklvnqgesvaiceqigdpatskgpverkvvrivtpgtis
    deallqerqdnllaaiwqdskgfgyatldissgrfrlsepadretmaaelqrtnpaelly
    aedfaemsliegrrglrrrplwefeidtarqqlnlqfgtrdlvgfgvenaprglcaagcl
    lqyakdtqrttlphirsitmereqdsiimdaatrrnleitqnlaggaentlasvldctvt
    pmgsrmlkrwlhmpvrdtrvllerqqtigalqdftaglqpvlrqvgdlerilarlalrta
    rprdlarmrhafqqlpelraqletvdsapvqalrekmgefaelrdlleraiidtppvlvr
    dggviasgyneeldewraladgatdylerlevrerertgldtlkvgfnavhgyyiqisrg
    qshlapinymrrqtlknaeryiipelkeyedkvltskgkalalekqlyeelfdlllphle
    alqqsasalaeldvlvnlaeraytlnytcptfidkpgiritegrhpvveqvlnepfianp
    lnlspqrrmliitgpnmggkstymrqtalialmayigsyvpaqkveigpidriftrvgaa
    ddlasgrstfmvemtetanilhnateyslvlmdeigagtstydglslawacaenlankik
    altlfathyfeltqlpekmegvanvhldalehgdtiafmhsvqdgaasksyglavaalag
    vpkevikrarqklrelesis
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng9B (B:)
    ahtpmmqqylrlkaqhpeillfyrmgdfyelfyddakrasqlldisltpipmagipyhav
    enylaklvnqgesvaiceqverkvvrivtpgtisdeallqerqdnllaaiwqdskgfgya
    tldissgrfrlsepadretmaaelqrtnpaellyaedfaemsliegrrglrrrplwefei
    dtarqqlnlqfgtrdlvgfgvenaprglcaagcllqyakdtqrttlphirsitmereqds
    iimdaatrrnleitqnlaggaentlasvldctvtpmgsrmlkrwlhmpvrdtrvllerqq
    tigalqdftaglqpvlrqvgdlerilarlalrtarprdlarmrhafqqlpelraqletvd
    sapvqalrekmgefaelrdlleraiidtppvlvrdggviasgyneeldewraladgatdy
    lerlevrerertgldtlkvgfnavhgyyiqisrgqshlapinymrrqtlknaeryiipel
    keyedkvltskgkalalekqlyeelfdlllphlealqqsasalaeldvlvnlaeraytln
    ytcptfidkpgiritegrhpvveqvlnepfianplnlspqrrmliitgpnmggkstymrq
    talialmayigsyvpaqkveigpidriftrvgastfmvemtetanilhnateyslvlmde
    igagtstydglslawacaenlankikaltlfathyfeltqlpekmegvanvhldalehgd
    tiafmhsvqdgaasksyglavaalagvpkevikrarqklrelesis
    

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.