PDB entry 1ng6

View 1ng6 on RCSB PDB site
Description: Structure of Cytosolic Protein of Unknown Function YqeY from Bacillus subtilis
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, Domain GatB/Yqey, pfam02637, DUF186, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG, UNKNOWN FUNCTION
Deposited on 2002-12-16, released 2003-07-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein yqeY
    Species: Bacillus subtilis [TaxId:1423]
    Gene: YQEY
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ng6a_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ng6A (A:)
    msllerlnqdmklymknrekdkltvvrmvkaslqneaiklkkdsltedeeltvlsrelkq
    rkdslqefsnanrldlvdkvqkeldilevylpeqlseeelrtivnetiaevgasskadmg
    kvmgaimpkvkgkadgslinklvssqls