PDB entry 1ng5

View 1ng5 on RCSB PDB site
Description: 2.0 A crystal structure of Staphylococcus aureus Sortase B
Class: hydrolase, transferase
Keywords: structural genomics, a new fold, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2002-12-16, released 2003-09-23
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.237
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sortase B
    Species: Staphylococcus aureus subsp. aureus
    Gene: SA0982
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ng5a_
  • Chain 'B':
    Compound: sortase B
    Species: Staphylococcus aureus subsp. aureus
    Gene: SA0982
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1ng5b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ng5A (A:)
    medkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqg
    ktnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsf
    yekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdv
    nvtvkdkimtlstcedaysettkrivvvakiikvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng5A (A:)
    qeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgktnh
    dylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfyekh
    kiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdvnvtv
    kdkimtlstcedaysettkrivvvakiikvs
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ng5B (B:)
    medkqeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqg
    ktnhdylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsf
    yekhkiiefdnkygkyqlqvfsayktttkdnyirtdfendqdyqqfldetkrksvinsdv
    nvtvkdkimtlstcedaysettkrivvvakiikvs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng5B (B:)
    qeranyeklqqkfqmlmskhqahvrpqfeslekinkdivgwiklsgtslnypvlqgktnh
    dylnldferehrrkgsifmdfrnelknlnhntilyghhvgdntmfdvledylkqsfyekh
    kiiefdnkygkyqlqvfsaykttirtdfendqdyqqfldetkrksvinsdvnvtvkdkim
    tlstcedaysettkrivvvakiikvs