PDB entry 1ng4

View 1ng4 on RCSB PDB site
Description: Structure of ThiO (glycine oxidase) from Bacillus subtilis
Class: oxidoreductase
Keywords: Flavoprotein, oxidase, OXIDOREDUCTASE
Deposited on 2002-12-16, released 2003-04-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glycine oxidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GOXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31616 (21-End)
      • see remark 999 (308)
    Domains in SCOPe 2.07: d1ng4a1, d1ng4a2
  • Chain 'B':
    Compound: glycine oxidase
    Species: Bacillus subtilis [TaxId:1423]
    Gene: GOXB
    Database cross-references and differences (RAF-indexed):
    • Uniprot O31616 (21-End)
      • see remark 999 (308)
    Domains in SCOPe 2.07: d1ng4b1, d1ng4b2
  • Heterogens: FAD, PEO, PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ng4A (A:)
    mghhhhhhhhhhssghiegrhmkrhyeavvigggiigsaiayylakenkntalfesgtmg
    grttsaaagmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfkla
    fseedvlqlrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvk
    aakmlgaeifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaf
    lpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvm
    kkaktmlppiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatg
    alisdlimnkevnqdwlhafridrkeavqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng4A (A:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlppiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ng4B (B:)
    mghhhhhhhhhhssghiegrhmkrhyeavvigggiigsaiayylakenkntalfesgtmg
    grttsaaagmlgahaeceerdaffdfamhsqrlykglgeelyalsgvdirqhnggmfkla
    fseedvlqlrqmddldsvswyskeevlekepyasgdifgasfiqddvhvepyfvckayvk
    aakmlgaeifehtpvlhverdgealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaf
    lpvkgeclsvwnddipltktlyhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvm
    kkaktmlppiqnmkvdrfwaglrpgtkdgkpyigrhpedsrilfaaghfrngillapatg
    alisdlimnkevnqdwlhafridrkeavqi
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ng4B (B:)
    mkrhyeavvigggiigsaiayylakenkntalfesgtmggrttsaaagmlgahaeceerd
    affdfamhsqrlykglgeelyalsgvdirqhnggmfklafseedvlqlrqmddldsvswy
    skeevlekepyasgdifgasfiqddvhvepyfvckayvkaakmlgaeifehtpvlhverd
    gealfiktpsgdvwanhvvvasgvwsgmffkqlglnnaflpvkgeclsvwnddipltktl
    yhdhcyivprksgrlvvgatmkpgdwsetpdlgglesvmkkaktmlppiqnmkvdrfwag
    lrpgtkdgkpyigrhpedsrilfaaghfrngillapatgalisdlimnkevnqdwlhafr
    idrk